PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn001361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 343aa    MW: 36698.7 Da    PI: 7.0954
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn001361genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.11.8e-12103147347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
       Achn001361 103 PWTEEEHRMFLLGLQKLGKGDWRGISRSYVVSRTPTQVASHAQKY 147
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.106.5E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.16396152IPR017930Myb domain
SuperFamilySSF466899.72E-1798153IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-1999151IPR006447Myb domain, plants
SMARTSM007174.4E-10100150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-10100146IPR009057Homeodomain-like
CDDcd001673.29E-9103148No hitNo description
PfamPF002493.4E-10103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKLFGVRL IDGSIRKSAS MGNLTHYTGS GSGSGPHGVA  60
AHNHLDSPDN TPDHGVAAAA DGYASEDFVP GSSSSRERKK GVPWTEEEHR MFLLGLQKLG  120
KGDWRGISRS YVVSRTPTQV ASHAQKYFIR QSNASRRKRR SSLFDMAADE SVDTPMESHD  180
FFPVNPPQAE TQTQNPLPEP PALDEVCESM DSTNSNDQEP VLQQPDSALC CYPVLFPAYV  240
SPFLPIPVPY WAGPGPSSEP AKTGTHEVLK PTAVHSKSPI NVDELVGMSK LSLGESIGNA  300
EAGPSSLSLK LLGGSNRQSA FHANPASESS HVNSSSNPIH AV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477144.11e-178PREDICTED: transcription factor MYB1R1
TrEMBLB9MUR91e-177B9MUR9_POPTR; Syringolide-induced protein 1-3-1B
STRINGPOPTR_0001s15510.11e-176(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70622431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-127MYB_related family protein